Lineage for d5tw3a1 (5tw3 A:3-429)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220424Family e.8.1.2: Reverse transcriptase [56686] (3 protein domains)
  6. 2220425Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2220467Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (172 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2288228Domain d5tw3a1: 5tw3 A:3-429 [331529]
    Other proteins in same PDB: d5tw3a2
    automated match to d2be2a1
    protein/DNA complex; complexed with 7n1, mg

Details for d5tw3a1

PDB Entry: 5tw3 (more details), 2.85 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 5-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)-4-fluorophenoxy)- 7-fluoro-2-naphthonitrile (jlj636), a non-nucleoside inhibitor
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d5tw3a1:

Sequence, based on SEQRES records: (download)

>d5tw3a1 e.8.1.2 (A:3-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdiviyq
ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
pivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaele
laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht
ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl
vklwyql

Sequence, based on observed residues (ATOM records): (download)

>d5tw3a1 e.8.1.2 (A:3-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdiviyq
ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
pivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaele
laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrhtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwyql

SCOPe Domain Coordinates for d5tw3a1:

Click to download the PDB-style file with coordinates for d5tw3a1.
(The format of our PDB-style files is described here.)

Timeline for d5tw3a1:

  • d5tw3a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5tw3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5tw3b_