Lineage for d5x7va_ (5x7v A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216056Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 2216057Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 2216070Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 2216071Protein automated matches [196446] (3 species)
    not a true protein
  7. 2216072Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [196447] (2 PDB entries)
  8. 2288225Domain d5x7va_: 5x7v A: [331526]
    automated match to d3kypa_

Details for d5x7va_

PDB Entry: 5x7v (more details), 2.8 Å

PDB Description: crystal structure of nucleosome assembly protein s (pfnaps) from plasmodium falciparum
PDB Compounds: (A:) Nucleosome assembly protein

SCOPe Domain Sequences for d5x7va_:

Sequence, based on SEQRES records: (download)

>d5x7va_ d.305.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
whnplsyyl

Sequence, based on observed residues (ATOM records): (download)

>d5x7va_ d.305.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
ekvvectrikwkegknpiaapkwsifewfttdelqdkpdvgelirreiwhnplsyyl

SCOPe Domain Coordinates for d5x7va_:

Click to download the PDB-style file with coordinates for d5x7va_.
(The format of our PDB-style files is described here.)

Timeline for d5x7va_:

  • d5x7va_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16