SCOPe 2.08: Domain d5u1rd2: 5u1r D:111-199

Lineage for d5u1rd2 (5u1r D:111-199)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d5u1rd2: 5u1r D:111-199 [331524]
   Other proteins in same PDB: d5u1ra1, d5u1ra2, d5u1ra3, d5u1rb1, d5u1rc1, d5u1rc2, d5u1rc3, d5u1rd1, d5u1re1, d5u1re2, d5u1rf_, d5u1rg1, d5u1rg2, d5u1rh1, d5u1rh2
   automated match to d2f54d2
   complexed with act, dif, gol, na
   missing some secondary structures that made up less than one-third of the common domain

Details for d5u1rd2

PDB Entry: 5u1r, 2.7 Å

PDB Description: structure of human mr1-diclofenac in complex with human mait a-f7 tcr

PDB Compounds: (D:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u1rd2:

Sequence; same for both SEQRES and ATOM records:

>d5u1rd2 b.1.1.2 (D:111-199) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d5u1rd2:

• d5u1rd2 first appeared in SCOPe 2.06
  
• d5u1rd2 appears in SCOPe 2.07