Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries) |
Domain d5u1rd2: 5u1r D:111-199 [331524] Other proteins in same PDB: d5u1ra1, d5u1ra2, d5u1ra3, d5u1rb1, d5u1rc1, d5u1rc2, d5u1rc3, d5u1rd1, d5u1re1, d5u1re2, d5u1rf_, d5u1rg1, d5u1rg2, d5u1rh1, d5u1rh2 automated match to d2f54d2 complexed with act, dif, gol, na missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 5u1r (more details), 2.7 Å
SCOPe Domain Sequences for d5u1rd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u1rd2 b.1.1.2 (D:111-199) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d5u1rd2: