SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x7vc_ (5x7v C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216056Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 2216057Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 2216070Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 2216071Protein automated matches [196446] (3 species)
    not a true protein
  7. 2216072Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [196447] (2 PDB entries)
  8. 2288221Domain d5x7vc_: 5x7v C: [331522]
    automated match to d3kypa_

Details for d5x7vc_

PDB Entry: 5x7v (more details), 2.8 Å

PDB Description: crystal structure of nucleosome assembly protein s (pfnaps) from plasmodium falciparum
PDB Compounds: (C:) Nucleosome assembly protein

SCOPe Domain Sequences for d5x7vc_:

Sequence, based on SEQRES records: (download)

>d5x7vc_ d.305.1.0 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
whnplsyyl

Sequence, based on observed residues (ATOM records): (download)

>d5x7vc_ d.305.1.0 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
ekvvectrikwkegknpiaavipkwsifewfttdelqdkpdvgelirreiwhnplsyyl

SCOPe Domain Coordinates for d5x7vc_:

Click to download the PDB-style file with coordinates for d5x7vc_.
(The format of our PDB-style files is described here.)

Timeline for d5x7vc_:

  • d5x7vc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16