SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tzul1 (5tzu L:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (831 PDB entries)
  8. 2288212Domain d5tzul1: 5tzu L:1-106 [331513]
    Other proteins in same PDB: d5tzul2
    automated match to d1dn0a1
    complexed with act, bma, gol, man, nag, so4

Details for d5tzul1

PDB Entry: 5tzu (more details), 2.1 Å

PDB Description: crystal structure of human cd47 ecd bound to fab of b6h12.2
PDB Compounds: (L:) Light Chain of Fab B6H12.2

SCOPe Domain Sequences for d5tzul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tzul1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspatlsvtpgdrvslscrasqtisdylhwyqqkshesprllikfasqsisgips
rfsgsgsgsdftlsinsvepedvgvyycqnghgfprtfgggtklei

SCOPe Domain Coordinates for d5tzul1:

Click to download the PDB-style file with coordinates for d5tzul1.
(The format of our PDB-style files is described here.)

Timeline for d5tzul1:

  • d5tzul1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16