Lineage for d1pkyb3 (1pky B:351-470)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371047Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1371048Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1371049Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1371050Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1371058Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)
  8. 1371064Domain d1pkyb3: 1pky B:351-470 [33151]
    Other proteins in same PDB: d1pkya1, d1pkya2, d1pkyb1, d1pkyb2, d1pkyc1, d1pkyc2, d1pkyd1, d1pkyd2

Details for d1pkyb3

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d1pkyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkyb3 c.49.1.1 (B:351-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]}
klriteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlv
lskgvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

SCOPe Domain Coordinates for d1pkyb3:

Click to download the PDB-style file with coordinates for d1pkyb3.
(The format of our PDB-style files is described here.)

Timeline for d1pkyb3: