SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uzxa_ (5uzx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2094618Species Burkholderia multivorans [TaxId:395019] [226459] (5 PDB entries)
  8. 2288199Domain d5uzxa_: 5uzx A: [331500]
    automated match to d3wxbb_
    complexed with cl, edo, nap, so4

Details for d5uzxa_

PDB Entry: 5uzx (more details), 1.5 Å

PDB Description: crystal structure of putative short-chain dehydrogenase/reductase from burkholderia multivorans with bound nadp
PDB Compounds: (A:) Putative short-chain alcohol dehydrogenase

SCOPe Domain Sequences for d5uzxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uzxa_ c.2.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}
prptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhalaeaypdrlrietldi
tqpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvdlmitnalspmrvve
tlaglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrsfaarhaqtplamvl
iapgwvrtelggpdarlsidesvpgvvdvllakrgragleyldyrgrtvrw

SCOPe Domain Coordinates for d5uzxa_:

Click to download the PDB-style file with coordinates for d5uzxa_.
(The format of our PDB-style files is described here.)

Timeline for d5uzxa_:

  • d5uzxa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16