Lineage for d5x7vb_ (5x7v B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010445Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 3010446Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 3010460Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 3010461Protein automated matches [196446] (6 species)
    not a true protein
  7. 3010465Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [196447] (1 PDB entry)
  8. 3010467Domain d5x7vb_: 5x7v B: [331498]
    automated match to d3kypa_

Details for d5x7vb_

PDB Entry: 5x7v (more details), 2.8 Å

PDB Description: crystal structure of nucleosome assembly protein s (pfnaps) from plasmodium falciparum
PDB Compounds: (B:) Nucleosome assembly protein

SCOPe Domain Sequences for d5x7vb_:

Sequence, based on SEQRES records: (download)

>d5x7vb_ d.305.1.0 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
whnplsyyl

Sequence, based on observed residues (ATOM records): (download)

>d5x7vb_ d.305.1.0 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
ekvvikwkegkwsifewfttpdvgelirreiwhnplsyyl

SCOPe Domain Coordinates for d5x7vb_:

Click to download the PDB-style file with coordinates for d5x7vb_.
(The format of our PDB-style files is described here.)

Timeline for d5x7vb_: