Lineage for d5uavb2 (5uav B:165-273)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721670Domain d5uavb2: 5uav B:165-273 [331493]
    Other proteins in same PDB: d5uava1, d5uava3, d5uavb1, d5uavb3, d5uavc1, d5uavc3, d5uavd1, d5uavd3, d5uave1, d5uave3
    automated match to d2izzc2
    complexed with ndp, peg, tfb

Details for d5uavb2

PDB Entry: 5uav (more details), 1.85 Å

PDB Description: structure of human pycr-1 complexed with nadph and l-tetrahydrofuroic acid
PDB Compounds: (B:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uavb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uavb2 a.100.1.0 (B:165-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmad

SCOPe Domain Coordinates for d5uavb2:

Click to download the PDB-style file with coordinates for d5uavb2.
(The format of our PDB-style files is described here.)

Timeline for d5uavb2: