Lineage for d5tppl2 (5tpp L:112-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (996 PDB entries)
  8. 2355838Domain d5tppl2: 5tpp L:112-214 [331489]
    automated match to d1etza2
    complexed with cit, na

Details for d5tppl2

PDB Entry: 5tpp (more details), 1.85 Å

PDB Description: crystal structure of dh270.5 (unliganded) from the dh270 broadly neutralizing n332-glycan dependent lineage
PDB Compounds: (L:) DH270.5 Fab heavy chain

SCOPe Domain Sequences for d5tppl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tppl2 b.1.1.0 (L:112-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d5tppl2:

Click to download the PDB-style file with coordinates for d5tppl2.
(The format of our PDB-style files is described here.)

Timeline for d5tppl2: