SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tppl1 (5tpp L:3-111)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (847 PDB entries)
  8. 2288187Domain d5tppl1: 5tpp L:3-111 [331488]
    automated match to d1etza1
    complexed with cit, na

Details for d5tppl1

PDB Entry: 5tpp (more details), 1.85 Å

PDB Description: crystal structure of dh270.5 (unliganded) from the dh270 broadly neutralizing n332-glycan dependent lineage
PDB Compounds: (L:) DH270.5 Fab heavy chain

SCOPe Domain Sequences for d5tppl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tppl1 b.1.1.0 (L:3-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqpasvsgspgqsitisctgtiydvgkfdlvswyqhhpgkapkyliyevkkwpsgvsh
rfsgsksgntasltisglqvedeadyyccsfggsaavvcgggtkvtvlg

SCOPe Domain Coordinates for d5tppl1:

Click to download the PDB-style file with coordinates for d5tppl1.
(The format of our PDB-style files is described here.)

Timeline for d5tppl1:

  • d5tppl1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16