SCOPe 2.08: Domain d5u1rg2: 5u1r G:117-242

Lineage for d5u1rg2 (5u1r G:117-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5u1rg2: 5u1r G:117-242 [331487]
   Other proteins in same PDB: d5u1ra1, d5u1ra3, d5u1rb2, d5u1rc1, d5u1rc3, d5u1rd2, d5u1rf_, d5u1rh1, d5u1rh2
   automated match to d2vlme2
   complexed with act, dif, gol, na

Details for d5u1rg2

PDB Entry: 5u1r, 2.7 Å

PDB Description: structure of human mr1-diclofenac in complex with human mait a-f7 tcr

PDB Compounds: (G:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d5u1rg2:

Sequence; same for both SEQRES and ATOM records:

>d5u1rg2 b.1.1.0 (G:117-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawg

Timeline for d5u1rg2:

• d5u1rg2 first appeared in SCOPe 2.06
  
• d5u1rg2 appears in SCOPe 2.07