SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v0va2 (5v0v A:196-387)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2009790Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2010124Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2010125Protein automated matches [254493] (5 species)
    not a true protein
  7. 2010151Species Horse (Equus caballus) [TaxId:9796] [256129] (14 PDB entries)
  8. 2288177Domain d5v0va2: 5v0v A:196-387 [331478]
    automated match to d1hk5a2
    complexed with 8qp, 8qs, so4, trs

Details for d5v0va2

PDB Entry: 5v0v (more details), 2.45 Å

PDB Description: crystal structure of equine serum albumin complex with etodolac
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5v0va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v0va2 a.126.1.0 (A:196-387) automated matches {Horse (Equus caballus) [TaxId: 9796]}
rlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhkecchgdllecadd
radlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpalaadfaedkeic
khykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaeadppacyrtvfdq
ftplveepkslv

SCOPe Domain Coordinates for d5v0va2:

Click to download the PDB-style file with coordinates for d5v0va2.
(The format of our PDB-style files is described here.)

Timeline for d5v0va2:

  • d5v0va2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16