SCOPe 2.06: Domain d5th9l2: 5th9 L:107-214

Lineage for d5th9l2 (5th9 L:107-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (4 PDB entries)

8. Domain d5th9l2: 5th9 L:107-214 [331475]
   Other proteins in same PDB: d5th9l1, d5th9m1, d5th9n_
   automated match to d1dn0a2
   complexed with ca, nco, zn

Details for d5th9l2

PDB Entry: 5th9, 3 Å

PDB Description: structure determination of a potent, selective antibody inhibitor of human mmp9 (gs-5745 bound to mmp-9)

PDB Compounds: (L:) GS-5745 Fab light chain

SCOPe Domain Sequences for d5th9l2:

Sequence; same for both SEQRES and ATOM records:

>d5th9l2 b.1.1.2 (L:107-214) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5th9l2:

• d5th9l2 is new in SCOPe 2.06-stable
  
• d5th9l2 appears in SCOPe 2.07
  
• d5th9l2 appears in the current release, SCOPe 2.08