SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5th9l2 (5th9 L:107-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2026085Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (4 PDB entries)
  8. 2288174Domain d5th9l2: 5th9 L:107-214 [331475]
    Other proteins in same PDB: d5th9l1, d5th9m1, d5th9n_
    automated match to d1dn0a2
    complexed with ca, nco, zn

Details for d5th9l2

PDB Entry: 5th9 (more details), 3 Å

PDB Description: structure determination of a potent, selective antibody inhibitor of human mmp9 (gs-5745 bound to mmp-9)
PDB Compounds: (L:) GS-5745 Fab light chain

SCOPe Domain Sequences for d5th9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5th9l2 b.1.1.2 (L:107-214) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5th9l2:

Click to download the PDB-style file with coordinates for d5th9l2.
(The format of our PDB-style files is described here.)

Timeline for d5th9l2:

  • d5th9l2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16