SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5th9n_ (5th9 N:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2288171Species Oryctolagus cuniculus [TaxId:9986] [331472] (1 PDB entry)
  8. 2288172Domain d5th9n_: 5th9 N: [331473]
    Other proteins in same PDB: d5th9l1, d5th9l2, d5th9m1, d5th9m2
    automated match to d1igml_
    complexed with ca, nco, zn

Details for d5th9n_

PDB Entry: 5th9 (more details), 3 Å

PDB Description: structure determination of a potent, selective antibody inhibitor of human mmp9 (gs-5745 bound to mmp-9)
PDB Compounds: (N:) GS-5745 Fab light chain

SCOPe Domain Sequences for d5th9n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5th9n_ b.1.1.1 (N:) automated matches {Oryctolagus cuniculus [TaxId: 9986]}
diqmtqspsslsasvgdrvtitckasqdvrntvawyqqkpgkapklliysssyrntgvpd
rfsgsgsgtdftltisslqaedvavyycqqhyitpytfgggtkvei

SCOPe Domain Coordinates for d5th9n_:

Click to download the PDB-style file with coordinates for d5th9n_.
(The format of our PDB-style files is described here.)

Timeline for d5th9n_:

  • d5th9n_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16