SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v0za_ (5v0z A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069791Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2069792Protein automated matches [190967] (29 species)
    not a true protein
  7. 2069951Species Staphylococcus aureus [TaxId:93062] [225621] (4 PDB entries)
  8. 2288162Domain d5v0za_: 5v0z A: [331463]
    automated match to d3ftta_
    complexed with cl, coa, edo, po4, unx

Details for d5v0za_

PDB Entry: 5v0z (more details), 1.26 Å

PDB Description: crystal structure of galactoside o-acetyltransferase complex with coa (p32 space group).
PDB Compounds: (A:) Putative acetyltransferase SACOL2570

SCOPe Domain Sequences for d5v0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v0za_ b.81.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
vrkidndlp

SCOPe Domain Coordinates for d5v0za_:

Click to download the PDB-style file with coordinates for d5v0za_.
(The format of our PDB-style files is described here.)

Timeline for d5v0za_:

  • d5v0za_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16