Lineage for d1e0ta3 (1e0t A:354-470)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700401Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 700402Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 700403Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 700404Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 700412Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)
  8. 700413Domain d1e0ta3: 1e0t A:354-470 [33146]
    Other proteins in same PDB: d1e0ta1, d1e0ta2, d1e0tb1, d1e0tb2, d1e0tc1, d1e0tc2, d1e0td1, d1e0td2

Details for d1e0ta3

PDB Entry: 1e0t (more details), 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase
PDB Compounds: (A:) pyruvate kinase

SCOP Domain Sequences for d1e0ta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ta3 c.49.1.1 (A:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]}
iteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlsk
gvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

SCOP Domain Coordinates for d1e0ta3:

Click to download the PDB-style file with coordinates for d1e0ta3.
(The format of our PDB-style files is described here.)

Timeline for d1e0ta3: