Lineage for d5v00a_ (5v00 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070601Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2070602Protein automated matches [190388] (22 species)
    not a true protein
  7. 2070661Species Pseudomonas fluorescens [TaxId:216595] [189073] (3 PDB entries)
  8. 2288145Domain d5v00a_: 5v00 A: [331446]
    automated match to d3esgb_
    complexed with fmt, gol

Details for d5v00a_

PDB Entry: 5v00 (more details), 1.8 Å

PDB Description: structure of hutd from pseudomonas fluorescens sbw25 (formate condition)
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5v00a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v00a_ b.82.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 216595]}
aisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqrv
itviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyharl
qwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrccliel
tqrg

SCOPe Domain Coordinates for d5v00a_:

Click to download the PDB-style file with coordinates for d5v00a_.
(The format of our PDB-style files is described here.)

Timeline for d5v00a_:

  • d5v00a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16