SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v00a_ (5v00 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070601Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2070602Protein automated matches [190388] (21 species)
    not a true protein
  7. 2070661Species Pseudomonas fluorescens [TaxId:216595] [189073] (3 PDB entries)
  8. 2288145Domain d5v00a_: 5v00 A: [331446]
    automated match to d3esgb_
    complexed with fmt, gol

Details for d5v00a_

PDB Entry: 5v00 (more details), 1.8 Å

PDB Description: structure of hutd from pseudomonas fluorescens sbw25 (formate condition)
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5v00a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v00a_ b.82.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 216595]}
aisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqrv
itviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyharl
qwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrccliel
tqrg

SCOPe Domain Coordinates for d5v00a_:

Click to download the PDB-style file with coordinates for d5v00a_.
(The format of our PDB-style files is described here.)

Timeline for d5v00a_:

  • d5v00a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16