SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v14a1 (5v14 A:1-90)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038595Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2038596Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2038597Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 protein domains)
  6. 2038635Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2288134Species Gallus gallus [TaxId:9031] [331435] (2 PDB entries)
  8. 2288135Domain d5v14a1: 5v14 A:1-90 [331436]
    automated match to d1zwma1

Details for d5v14a1

PDB Entry: 5v14 (more details), 2.3 Å

PDB Description: crystal structure of chicken gamma s crystallin
PDB Compounds: (A:) Gamma S-crystallin

SCOPe Domain Sequences for d5v14a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v14a1 b.11.1.1 (A:1-90) gamma-Crystallin {Gallus gallus [TaxId: 9031]}
sragpkvtfyedknflgrryecdadcpdfhtylnrcnsirveggtwvayerpnysgnmyv
lrrgeypdyhhwmglndrlgsckavhipsg

SCOPe Domain Coordinates for d5v14a1:

Click to download the PDB-style file with coordinates for d5v14a1.
(The format of our PDB-style files is described here.)

Timeline for d5v14a1:

  • d5v14a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5v14a2