SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uatb2 (5uat B:165-273)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003567Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2003568Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2003777Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2003778Protein automated matches [226851] (33 species)
    not a true protein
  7. 2003852Species Human (Homo sapiens) [TaxId:9606] [225061] (18 PDB entries)
  8. 2288129Domain d5uatb2: 5uat B:165-273 [331430]
    Other proteins in same PDB: d5uata1, d5uatb1, d5uatb3, d5uatc1, d5uatc3, d5uatd1, d5uatd3, d5uate1, d5uate3
    automated match to d2izzc2
    complexed with ndp, peg, so4

Details for d5uatb2

PDB Entry: 5uat (more details), 1.92 Å

PDB Description: structure of human pycr-1 complexed with nadph
PDB Compounds: (B:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uatb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uatb2 a.100.1.0 (B:165-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmad

SCOPe Domain Coordinates for d5uatb2:

Click to download the PDB-style file with coordinates for d5uatb2.
(The format of our PDB-style files is described here.)

Timeline for d5uatb2:

  • d5uatb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16