SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v0gc1 (5v0g C:1-347)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084960Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2084961Protein automated matches [190150] (24 species)
    not a true protein
  7. 2288113Species Yersinia pestis [TaxId:632] [331414] (1 PDB entry)
  8. 2288122Domain d5v0gc1: 5v0g C:1-347 [331423]
    Other proteins in same PDB: d5v0gc2
    automated match to d4lfyb_
    complexed with unl, zn

Details for d5v0gc1

PDB Entry: 5v0g (more details), 2.41 Å

PDB Description: crystal structure of dihydroorotase pyrc from yersinia pestis in complex with zinc and unknown ligand at 2.4 a resolution.
PDB Compounds: (C:) dihydroorotase

SCOPe Domain Sequences for d5v0gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v0gc1 c.1.9.0 (C:1-347) automated matches {Yersinia pestis [TaxId: 632]}
mtaqpqtlkirrpddwhihlrddemlstvlpytsevfaraivmpnlaqpittvasaiayr
erilaavpaghkftplmtcyltnsldakelttgfeqgvftaaklypanattnsthgvsdi
paiyplfeqmqkigmpllihgevtdaavdifdrearfidqilepirqkfpelkivfehit
tkdaadyvlagnrflgatvtpqhlmfnrnhmlvggirphlfclpilkrsthqqalraava
sgsdrfflgtdsaphakhrkesscgcagvfnapaalpayasvfeelnalqhleafcalng
prfyglpvnddvvelvrtpflqpeeiplgnesvipflagqtlnwsvk

SCOPe Domain Coordinates for d5v0gc1:

Click to download the PDB-style file with coordinates for d5v0gc1.
(The format of our PDB-style files is described here.)

Timeline for d5v0gc1:

  • d5v0gc1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16