Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d5u1re1: 5u1r E:2-116 [331420] Other proteins in same PDB: d5u1ra1, d5u1ra3, d5u1rb2, d5u1rc1, d5u1rc3, d5u1rd2, d5u1rf_, d5u1rh1, d5u1rh2 automated match to d2axha1 complexed with act, dif, gol, na |
PDB Entry: 5u1r (more details), 2.7 Å
SCOPe Domain Sequences for d5u1re1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u1re1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle
Timeline for d5u1re1: