Lineage for d5v0ga_ (5v0g A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2096705Protein automated matches [190150] (26 species)
    not a true protein
  7. 2096915Species Yersinia pestis [TaxId:632] [331414] (1 PDB entry)
  8. 2096916Domain d5v0ga_: 5v0g A: [331415]
    Other proteins in same PDB: d5v0gc2
    automated match to d4lfyb_
    complexed with unl, zn

Details for d5v0ga_

PDB Entry: 5v0g (more details), 2.41 Å

PDB Description: crystal structure of dihydroorotase pyrc from yersinia pestis in complex with zinc and unknown ligand at 2.4 a resolution.
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d5v0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v0ga_ c.1.9.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
qpqtlkirrpddwhihlrddemlstvlpytsevfaraivmpnlaqpittvasaiayreri
laavpaghkftplmtcyltnsldakelttgfeqgvftaaklypanattnsthgvsdipai
yplfeqmqkigmpllihgevtdaavdifdrearfidqilepirqkfpelkivfehittkd
aadyvlagnrflgatvtpqhlmfnrnhmlvggirphlfclpilkrsthqqalraavasgs
drfflgtdsaphakhrkesscgcagvfnapaalpayasvfeelnalqhleafcalngprf
yglpvnddvvelvrtpflqpeeiplgnesvipflagqtlnwsvkr

SCOPe Domain Coordinates for d5v0ga_:

Click to download the PDB-style file with coordinates for d5v0ga_.
(The format of our PDB-style files is described here.)

Timeline for d5v0ga_: