Lineage for d5ichb2 (5ich B:248-334)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007772Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 3007773Protein automated matches [190942] (7 species)
    not a true protein
  7. 3007784Species Enterococcus faecalis [TaxId:226185] [330981] (5 PDB entries)
  8. 3007790Domain d5ichb2: 5ich B:248-334 [331405]
    Other proteins in same PDB: d5icha1, d5icha3, d5ichb1, d5ichb3
    automated match to d1vqza1
    complexed with sh5

Details for d5ichb2

PDB Entry: 5ich (more details), 1.85 Å

PDB Description: crystal structure of enterococcus faecalis lipoate-protein ligase a (lpla-2) in complex with 8bo-amp
PDB Compounds: (B:) Lipoate--protein ligase

SCOPe Domain Sequences for d5ichb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ichb2 d.224.1.0 (B:248-334) automated matches {Enterococcus faecalis [TaxId: 226185]}
kspafnlerrhrfpigsiemkmnvadgaiqeikifgdffglgeikdvediltgvkydkas
leeaidqidvkkyfgniekedllgliy

SCOPe Domain Coordinates for d5ichb2:

Click to download the PDB-style file with coordinates for d5ichb2.
(The format of our PDB-style files is described here.)

Timeline for d5ichb2: