Lineage for d5ichb1 (5ich B:1-247)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2186951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2187333Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2187334Protein automated matches [226887] (13 species)
    not a true protein
  7. 2287678Species Enterococcus faecalis [TaxId:226185] [330979] (5 PDB entries)
  8. 2288103Domain d5ichb1: 5ich B:1-247 [331404]
    Other proteins in same PDB: d5icha2, d5icha3, d5ichb2, d5ichb3
    automated match to d1vqza2
    complexed with sh5

Details for d5ichb1

PDB Entry: 5ich (more details), 1.85 Å

PDB Description: crystal structure of enterococcus faecalis lipoate-protein ligase a (lpla-2) in complex with 8bo-amp
PDB Compounds: (B:) Lipoate--protein ligase

SCOPe Domain Sequences for d5ichb1:

Sequence, based on SEQRES records: (download)

>d5ichb1 d.104.1.0 (B:1-247) automated matches {Enterococcus faecalis [TaxId: 226185]}
mifvpnenndprvnlaietylltempldepillfyinepsiiigrnqntieeinkeyvde
hgihvvrrlsgggavyhdhgnlnfsfimpddgnsfrdfakvtqpiiqalhdlgvegaelk
grndlvindmkfsgnamyatngrmfahgtlmfdsdidevvntlkvrkdkieskgiksvrs
rvtnikpflsedkqemtteefrqeillkifgvdsidqvktyeltdqdwaainkiseqyyr
nwdwnyg

Sequence, based on observed residues (ATOM records): (download)

>d5ichb1 d.104.1.0 (B:1-247) automated matches {Enterococcus faecalis [TaxId: 226185]}
mifvpnenndprvnlaietylltempldepillfyinepsiiigrnqntieeinkeyvde
hgihvvrrlsgggavyhdhgnlnfsfimpddfakvtqpiiqalhdlgvegaelkgrndlv
indmkfsgnamyatngrmfahgtlmfdsdidevvntlvtnikpflsedkqemtteefrqe
illkifgvdsidqvktyeltdqdwaainkiseqyyrnwdwnyg

SCOPe Domain Coordinates for d5ichb1:

Click to download the PDB-style file with coordinates for d5ichb1.
(The format of our PDB-style files is described here.)

Timeline for d5ichb1:

  • d5ichb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16