![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (243 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries) |
![]() | Domain d5uawe1: 5uaw E:1-164 [331400] Other proteins in same PDB: d5uawa2, d5uawb2, d5uawb3, d5uawc2, d5uawd2, d5uawd3, d5uawe2, d5uawe3 automated match to d2izza1 complexed with so4 |
PDB Entry: 5uaw (more details), 1.85 Å
SCOPe Domain Sequences for d5uawe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uawe1 c.2.1.0 (E:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
Timeline for d5uawe1: