SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u15b2 (5u15 B:112-210)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (610 PDB entries)
  8. 2288096Domain d5u15b2: 5u15 B:112-210 [331397]
    Other proteins in same PDB: d5u15b1, d5u15l1
    automated match to d1aqkl2

Details for d5u15b2

PDB Entry: 5u15 (more details), 2.26 Å

PDB Description: crystal structure of dh270.uca3 (unliganded) from the dh270 broadly neutralizing n332-glycan dependent lineage
PDB Compounds: (B:) DH270.UCA3 light chain

SCOPe Domain Sequences for d5u15b2:

Sequence, based on SEQRES records: (download)

>d5u15b2 b.1.1.2 (B:112-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektv

Sequence, based on observed residues (ATOM records): (download)

>d5u15b2 b.1.1.2 (B:112-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkgapsvtlfppeelatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkya
assylsltqwksyscqvthegstvektv

SCOPe Domain Coordinates for d5u15b2:

Click to download the PDB-style file with coordinates for d5u15b2.
(The format of our PDB-style files is described here.)

Timeline for d5u15b2:

  • d5u15b2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5u15b1