SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5twnb_ (5twn B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220913Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 protein domains)
  6. 2221226Protein automated matches [190260] (27 species)
    not a true protein
  7. 2288056Species Hepatitis c virus genotype 1b (isolate con1) [TaxId:333284] [331357] (1 PDB entry)
  8. 2288088Domain d5twnb_: 5twn B: [331389]
    automated match to d3q0za_
    protein/RNA complex; complexed with 23e, 7ng, so4

Details for d5twnb_

PDB Entry: 5twn (more details), 3.04 Å

PDB Description: crystal structure of the hepatitis c virus ns5b rna- dependent rna polymerase in complex with 5-[3-(tert-butylcarbamoyl)phenyl]-6- (ethylamino)-2-(4-fluorophenyl)-n-methylfuro[2,3-b]pyridine-3- carboxamide
PDB Compounds: (B:) ns5b RNA- dependent RNA polymerase

SCOPe Domain Sequences for d5twnb_:

Sequence, based on SEQRES records: (download)

>d5twnb_ e.8.1.4 (B:) automated matches {Hepatitis c virus genotype 1b (isolate con1) [TaxId: 333284]}
smsytwtgalitpcaaeetklpinalsnsllrhhnlvyattsrsaslrqkkvtfdrlqvl
ddhyrdvlkemkakastvkakllsveeackltpphsarskfgygakdvrnlsskavnhir
svwkdlledtetpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
tlpqavmgssygfqyspgqrveflvnawkakkcpmgfaydtrcfdstvtendirveesiy
qccdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkaa
aacraaklqdctmlvcgddlvvicesagtqedeaslrafteamtrysappgdppkpeydl
elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw
armilmthffsillaqeqlekaldcqiygacysiepldlpqiiqrlhglsafslhsyspg
einrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavrtklkltpip
aasqldlsswfvagysggdiyhsl

Sequence, based on observed residues (ATOM records): (download)

>d5twnb_ e.8.1.4 (B:) automated matches {Hepatitis c virus genotype 1b (isolate con1) [TaxId: 333284]}
smsytwtgalitpcyattsrsaslrqkkvtfdrlqvlddhyrdvlkemkakastvkakll
sveeackltpphsarskfgygakdvrnlsskavnhirsvwkdlledtetpidttimakne
vfcvqpkparlivfpdlgvrvcekmalydvvstlpqavmgssygfqyspgqrveflvnaw
kakkcpmgfaydtrcfdstvtendirveesiyqccdlapearqairslterlyiggpltn
skgqncgyrrcrasgvlttscgntltcylkaaaacraaklqdctmlvcgddlvvicesag
tqedeaslrafteamtrysappgdppkpeydlelitscssnvsvahdasgkrvyyltrdp
ttplaraawetarhtpvnswlgniimyaptlwarmilmthffsillaqeqlekaldcqiy
gacysiepldlpqiiqrlhglsafslhsyspgeinrvasclrklgvpplrvwrhrarsvr
arllsqggraatcgkylfnwavrtklkltpipaasqldlsswfvagysggdiyhsl

SCOPe Domain Coordinates for d5twnb_:

Click to download the PDB-style file with coordinates for d5twnb_.
(The format of our PDB-style files is described here.)

Timeline for d5twnb_:

  • d5twnb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16