SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpll2 (5tpl L:112-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (610 PDB entries)
  8. 2288083Domain d5tpll2: 5tpl L:112-212 [331384]
    Other proteins in same PDB: d5tpll1
    automated match to d2fb4l2

Details for d5tpll2

PDB Entry: 5tpl (more details), 2.5 Å

PDB Description: crystal structure of dh270.3 (unliganded) from the dh270 broadly neutralizing n332-glycan dependent lineage
PDB Compounds: (L:) DH270.3 Fab light chain

SCOPe Domain Sequences for d5tpll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpll2 b.1.1.2 (L:112-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d5tpll2:

Click to download the PDB-style file with coordinates for d5tpll2.
(The format of our PDB-style files is described here.)

Timeline for d5tpll2:

  • d5tpll2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16