Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries) |
Domain d5tz2l1: 5tz2 L:1-106 [331378] Other proteins in same PDB: d5tz2l2 automated match to d1dn0a1 complexed with gol, nag |
PDB Entry: 5tz2 (more details), 2.3 Å
SCOPe Domain Sequences for d5tz2l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tz2l1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspatlslspgeratlscrasqsvnnrlawyqqkpgqaprllihwastraigipa rfsgsgsgtdftltisslepedfavyycqqgaswpftfgqgtkvei
Timeline for d5tz2l1: