SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uate1 (5uat E:1-164)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (226 species)
    not a true protein
  7. 2095073Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2288074Domain d5uate1: 5uat E:1-164 [331375]
    Other proteins in same PDB: d5uata2, d5uatb2, d5uatb3, d5uatc2, d5uatc3, d5uatd2, d5uatd3, d5uate2, d5uate3
    automated match to d2izza1
    complexed with ndp, peg, so4

Details for d5uate1

PDB Entry: 5uat (more details), 1.92 Å

PDB Description: structure of human pycr-1 complexed with nadph
PDB Compounds: (E:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uate1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uate1 c.2.1.0 (E:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

SCOPe Domain Coordinates for d5uate1:

Click to download the PDB-style file with coordinates for d5uate1.
(The format of our PDB-style files is described here.)

Timeline for d5uate1:

  • d5uate1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16