SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lgjb2 (5lgj B:331-438)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (847 PDB entries)
  8. 2288066Domain d5lgjb2: 5lgj B:331-438 [331367]
    automated match to d1o0va2
    complexed with bma, gol, man, nag, pg4, so4; mutant

Details for d5lgjb2

PDB Entry: 5lgj (more details), 2.6 Å

PDB Description: the crystal structure of ige fc mutant - p333c
PDB Compounds: (B:) ig epsilon chain c region

SCOPe Domain Sequences for d5lgjb2:

Sequence, based on SEQRES records: (download)

>d5lgjb2 b.1.1.0 (B:331-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sncrgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkee
kqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Sequence, based on observed residues (ATOM records): (download)

>d5lgjb2 b.1.1.0 (B:331-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snvsaylsrpspfdlfirksptitclvvdlapkgtvqltwsrasgkpvnhstrkeekqrn
gtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

SCOPe Domain Coordinates for d5lgjb2:

Click to download the PDB-style file with coordinates for d5lgjb2.
(The format of our PDB-style files is described here.)

Timeline for d5lgjb2:

  • d5lgjb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16