SCOPe 2.08: Domain d5te3a_: 5te3 A:

Lineage for d5te3a_ (5te3 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.2: Rhodopsin-like [81320] (2 proteins)
   Individual TM segments have a number of kinks and distortions

6. Protein Rhodopsin [56876] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56877] (9 PDB entries)
   Uniprot P02699

8. Domain d5te3a_: 5te3 A: [331363]
   automated match to d1u19a_
   complexed with bog, plm, so4

Details for d5te3a_

PDB Entry: 5te3, 2.7 Å

PDB Description: crystal structure of bos taurus opsin at 2.7 angstrom

PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d5te3a_:

Sequence; same for both SEQRES and ATOM records:

>d5te3a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgkn

Timeline for d5te3a_:

• d5te3a_ first appeared in SCOPe 2.06
  
• d5te3a_ appears in SCOPe 2.07