Lineage for d5te3a_ (5te3 A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225286Family f.13.1.2: Rhodopsin-like [81320] (2 protein domains)
    Individual TM segments have a number of kinks and distortions
  6. 2225287Protein Rhodopsin [56876] (1 species)
  7. 2225288Species Cow (Bos taurus) [TaxId:9913] [56877] (9 PDB entries)
    Uniprot P02699
  8. 2288062Domain d5te3a_: 5te3 A: [331363]
    automated match to d1u19a_
    complexed with bma, bog, man, nag, plm, so4

Details for d5te3a_

PDB Entry: 5te3 (more details), 2.7 Å

PDB Description: crystal structure of bos taurus opsin at 2.7 angstrom
PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d5te3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5te3a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgkn

SCOPe Domain Coordinates for d5te3a_:

Click to download the PDB-style file with coordinates for d5te3a_.
(The format of our PDB-style files is described here.)

Timeline for d5te3a_:

  • d5te3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16