SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5te3a_ (5te3 A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225286Family f.13.1.2: Rhodopsin-like [81320] (2 protein domains)
    Individual TM segments have a number of kinks and distortions
  6. 2225287Protein Rhodopsin [56876] (1 species)
  7. 2225288Species Cow (Bos taurus) [TaxId:9913] [56877] (9 PDB entries)
    Uniprot P02699
  8. 2288062Domain d5te3a_: 5te3 A: [331363]
    automated match to d1u19a_
    complexed with bma, bog, man, nag, plm, so4

Details for d5te3a_

PDB Entry: 5te3 (more details), 2.7 Å

PDB Description: crystal structure of bos taurus opsin at 2.7 angstrom
PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d5te3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5te3a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgkn

SCOPe Domain Coordinates for d5te3a_:

Click to download the PDB-style file with coordinates for d5te3a_.
(The format of our PDB-style files is described here.)

Timeline for d5te3a_:

  • d5te3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16