Lineage for d5twma_ (5twm A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220913Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 protein domains)
  6. 2220921Protein Viral RNA polymerase [56695] (18 species)
  7. 2288058Species Hepatitis c virus genotype 2a (isolate jfh-1) [TaxId:356411] [331359] (1 PDB entry)
  8. 2288059Domain d5twma_: 5twm A: [331360]
    automated match to d3q0za_
    protein/RNA complex; complexed with 7ng, pe5, pg4, so4

Details for d5twma_

PDB Entry: 5twm (more details), 1.97 Å

PDB Description: crystal structure of the hepatitis c virus genotype 2a strain jfh1 l30s ns5b rna-dependent rna polymerase in complex with 5-[3-(tert- butylcarbamoyl)phenyl]-6-(ethylamino)-2-(4-fluorophenyl)-n- methylfuro[2,3-b]pyridine-3-carboxamide
PDB Compounds: (A:) NS5B RNA-dependent RNA polymerase

SCOPe Domain Sequences for d5twma_:

Sequence, based on SEQRES records: (download)

>d5twma_ e.8.1.4 (A:) Viral RNA polymerase {Hepatitis c virus genotype 2a (isolate jfh-1) [TaxId: 356411]}
smsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqvl
dahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledpqtpipttimaknevfcvdpakggkkparlivypdlgvrvcekmalyditq
klpqavmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiy
qacslpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkal
aackaagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydl
elitscssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyaptiw
vrmvlmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshh
eltrvasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplp
earlldlsswftvgagggdifhs

Sequence, based on observed residues (ATOM records): (download)

>d5twma_ e.8.1.4 (A:) Viral RNA polymerase {Hepatitis c virus genotype 2a (isolate jfh-1) [TaxId: 356411]}
smsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqvl
dahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledpqtpipttimaknevfcvdgkkparlivypdlgvrvcekmalyditqklpq
avmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiyqacs
lpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkalaack
aagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydlelit
scssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyaptiwvrmv
lmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshheltr
vasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplpearl
ldlsswftvgagggdifhs

SCOPe Domain Coordinates for d5twma_:

Click to download the PDB-style file with coordinates for d5twma_.
(The format of our PDB-style files is described here.)

Timeline for d5twma_:

  • d5twma_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16