SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5twma_ (5twm A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220913Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 protein domains)
  6. 2220921Protein Viral RNA polymerase [56695] (18 species)
  7. 2288058Species Hepatitis c virus genotype 2a (isolate jfh-1) [TaxId:356411] [331359] (1 PDB entry)
  8. 2288059Domain d5twma_: 5twm A: [331360]
    automated match to d3q0za_
    protein/RNA complex; complexed with 7ng, pe5, pg4, so4

Details for d5twma_

PDB Entry: 5twm (more details), 1.97 Å

PDB Description: crystal structure of the hepatitis c virus genotype 2a strain jfh1 l30s ns5b rna-dependent rna polymerase in complex with 5-[3-(tert- butylcarbamoyl)phenyl]-6-(ethylamino)-2-(4-fluorophenyl)-n- methylfuro[2,3-b]pyridine-3-carboxamide
PDB Compounds: (A:) NS5B RNA-dependent RNA polymerase

SCOPe Domain Sequences for d5twma_:

Sequence, based on SEQRES records: (download)

>d5twma_ e.8.1.4 (A:) Viral RNA polymerase {Hepatitis c virus genotype 2a (isolate jfh-1) [TaxId: 356411]}
smsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqvl
dahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledpqtpipttimaknevfcvdpakggkkparlivypdlgvrvcekmalyditq
klpqavmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiy
qacslpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkal
aackaagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydl
elitscssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyaptiw
vrmvlmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshh
eltrvasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplp
earlldlsswftvgagggdifhs

Sequence, based on observed residues (ATOM records): (download)

>d5twma_ e.8.1.4 (A:) Viral RNA polymerase {Hepatitis c virus genotype 2a (isolate jfh-1) [TaxId: 356411]}
smsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqvl
dahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledpqtpipttimaknevfcvdgkkparlivypdlgvrvcekmalyditqklpq
avmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiyqacs
lpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkalaack
aagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydlelit
scssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyaptiwvrmv
lmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshheltr
vasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplpearl
ldlsswftvgagggdifhs

SCOPe Domain Coordinates for d5twma_:

Click to download the PDB-style file with coordinates for d5twma_.
(The format of our PDB-style files is described here.)

Timeline for d5twma_:

  • d5twma_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16