Lineage for d5twna_ (5twn A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220913Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 protein domains)
  6. 2221226Protein automated matches [190260] (29 species)
    not a true protein
  7. 2288056Species Hepatitis c virus genotype 1b (isolate con1) [TaxId:333284] [331357] (7 PDB entries)
  8. 2288057Domain d5twna_: 5twn A: [331358]
    automated match to d3q0za_
    protein/RNA complex; complexed with 23e, 7ng, so4

Details for d5twna_

PDB Entry: 5twn (more details), 3.04 Å

PDB Description: crystal structure of the hepatitis c virus ns5b rna- dependent rna polymerase in complex with 5-[3-(tert-butylcarbamoyl)phenyl]-6- (ethylamino)-2-(4-fluorophenyl)-n-methylfuro[2,3-b]pyridine-3- carboxamide
PDB Compounds: (A:) ns5b RNA- dependent RNA polymerase

SCOPe Domain Sequences for d5twna_:

Sequence, based on SEQRES records: (download)

>d5twna_ e.8.1.4 (A:) automated matches {Hepatitis c virus genotype 1b (isolate con1) [TaxId: 333284]}
smsytwtgalitpcaaeetklpinalsnsllrhhnlvyattsrsaslrqkkvtfdrlqvl
ddhyrdvlkemkakastvkakllsveeackltpphsarskfgygakdvrnlsskavnhir
svwkdlledtetpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
tlpqavmgssygfqyspgqrveflvnawkakkcpmgfaydtrcfdstvtendirveesiy
qccdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkaa
aacraaklqdctmlvcgddlvvicesagtqedeaslrafteamtrysappgdppkpeydl
elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw
armilmthffsillaqeqlekaldcqiygacysiepldlpqiiqrlhglsafslhsyspg
einrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavrtklkltpip
aasqldlsswfvagysggdiyhslsrarprwfm

Sequence, based on observed residues (ATOM records): (download)

>d5twna_ e.8.1.4 (A:) automated matches {Hepatitis c virus genotype 1b (isolate con1) [TaxId: 333284]}
smsytwtgalitpcyattsrsaslrqkkvtfdrlqvlddhyrdvlkemkakastvkakll
sveeackltpphsarskfgygakdvrnlsskavnhirsvwkdlledtetpidttimakne
vfcvqpekggrkparlivfpdlgvrvcekmalydvvstlpqavmgssygfqyspgqrvef
lvnawkakkcpmgfaydtrcfdstvtendirveesiyqccdlapearqairslterlyig
gpltnskgqncgyrrcrasgvlttscgntltcylkaaaacraaklqdctmlvcgddlvvi
cesagtqedeaslrafteamtrysappgdppkpeydlelitscssnvsvahdasgkrvyy
ltrdpttplaraawetarhtpvnswlgniimyaptlwarmilmthffsillaqeqlekal
dcqiygacysiepldlpqiiqrlhglsafslhsyspgeinrvasclrklgvpplrvwrhr
arsvrarllsqggraatcgkylfnwavrtklkltpipaasqldlsswfvagysggdiyhs
lsrarprwfm

SCOPe Domain Coordinates for d5twna_:

Click to download the PDB-style file with coordinates for d5twna_.
(The format of our PDB-style files is described here.)

Timeline for d5twna_:

  • d5twna_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16