Lineage for d5th9m2 (5th9 M:107-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2026085Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (4 PDB entries)
  8. 2288047Domain d5th9m2: 5th9 M:107-214 [331348]
    Other proteins in same PDB: d5th9l1, d5th9m1, d5th9n_
    automated match to d1dn0a2
    complexed with ca, nco, zn

Details for d5th9m2

PDB Entry: 5th9 (more details), 3 Å

PDB Description: structure determination of a potent, selective antibody inhibitor of human mmp9 (gs-5745 bound to mmp-9)
PDB Compounds: (M:) GS-5745 Fab light chain

SCOPe Domain Sequences for d5th9m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5th9m2 b.1.1.2 (M:107-214) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5th9m2:

Click to download the PDB-style file with coordinates for d5th9m2.
(The format of our PDB-style files is described here.)

Timeline for d5th9m2:

  • d5th9m2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16