SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5th9m1 (5th9 M:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2029310Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (16 PDB entries)
  8. 2288046Domain d5th9m1: 5th9 M:1-106 [331347]
    Other proteins in same PDB: d5th9l2, d5th9m2, d5th9n_
    automated match to d1dn0a1
    complexed with ca, nco, zn

Details for d5th9m1

PDB Entry: 5th9 (more details), 3 Å

PDB Description: structure determination of a potent, selective antibody inhibitor of human mmp9 (gs-5745 bound to mmp-9)
PDB Compounds: (M:) GS-5745 Fab light chain

SCOPe Domain Sequences for d5th9m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5th9m1 b.1.1.0 (M:1-106) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
diqmtqspsslsasvgdrvtitckasqdvrntvawyqqkpgkapklliysssyrntgvpd
rfsgsgsgtdftltisslqaedvavyycqqhyitpytfgggtkvei

SCOPe Domain Coordinates for d5th9m1:

Click to download the PDB-style file with coordinates for d5th9m1.
(The format of our PDB-style files is described here.)

Timeline for d5th9m1:

  • d5th9m1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16