SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lhqd_ (4lhq D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020506Species Vicugna pacos [TaxId:30538] [189756] (26 PDB entries)
  8. 2288028Domain d4lhqd_: 4lhq D: [331329]
    automated match to d4ocmc_

Details for d4lhqd_

PDB Entry: 4lhq (more details), 2.3 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh8)
PDB Compounds: (D:) Camelid nanobody

SCOPe Domain Sequences for d4lhqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhqd_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvetgggtvqtggslrlscsasggsfsrnamgwfrqapgkerefvaainwsasstyyr
dsvkgrftvsrdnakntvylhlnslkledtaayycagssvyaempyadsvkatsynywgq
gtqvtvss

SCOPe Domain Coordinates for d4lhqd_:

Click to download the PDB-style file with coordinates for d4lhqd_.
(The format of our PDB-style files is described here.)

Timeline for d4lhqd_:

  • d4lhqd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16

View in 3D
Domains from other chains:
(mouse over for more information)
d4lhqb_