Lineage for d5pkla_ (5pkl A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071116Family b.82.2.14: Histone demethylase core [254153] (4 protein domains)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 2071178Protein automated matches [254635] (1 species)
    not a true protein
  7. 2071179Species Human (Homo sapiens) [TaxId:9606] [255633] (263 PDB entries)
  8. 2287981Domain d5pkla_: 5pkl A: [331282]
    automated match to d3dxua_
    complexed with edo, mg, ni, oga, so4, zn

Details for d5pkla_

PDB Entry: 5pkl (more details), 1.35 Å

PDB Description: pandda analysis group deposition -- crystal structure of jmjd2d after initial refinement with no ligand modelled (structure 106)
PDB Compounds: (A:) Lysine-specific demethylase 4D

SCOPe Domain Sequences for d5pkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pkla_ b.82.2.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
scgearvtfsmdafvrilqperydlwkrgqd

SCOPe Domain Coordinates for d5pkla_:

Click to download the PDB-style file with coordinates for d5pkla_.
(The format of our PDB-style files is described here.)

Timeline for d5pkla_:

  • d5pkla_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16