Lineage for d1pkn_3 (1pkn 396-530)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24606Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 24607Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 24608Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 24609Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 24639Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (4 PDB entries)
  8. 24656Domain d1pkn_3: 1pkn 396-530 [33125]
    Other proteins in same PDB: d1pkn_1, d1pkn_2

Details for d1pkn_3

PDB Entry: 1pkn (more details), 2.9 Å

PDB Description: structure of rabbit muscle pyruvate kinase complexed with mn2+, k+, and pyruvate

SCOP Domain Sequences for d1pkn_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkn_3 c.49.1.1 (396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
elarssshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkaagffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOP Domain Coordinates for d1pkn_3:

Click to download the PDB-style file with coordinates for d1pkn_3.
(The format of our PDB-style files is described here.)

Timeline for d1pkn_3: