Lineage for d5iclb2 (5icl B:248-334)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213792Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2213793Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2213847Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 2213848Protein automated matches [190942] (5 species)
    not a true protein
  7. 2287680Species Enterococcus faecalis [TaxId:226185] [330981] (5 PDB entries)
  8. 2287948Domain d5iclb2: 5icl B:248-334 [331249]
    Other proteins in same PDB: d5icla1, d5icla3, d5iclb1, d5iclb3
    automated match to d1vqza1
    complexed with laq

Details for d5iclb2

PDB Entry: 5icl (more details), 1.8 Å

PDB Description: crystal structure of enterococcus faecalis lipoate-protein ligase a (lpla-2) in complex with lipoyl-amp
PDB Compounds: (B:) Lipoate--protein ligase

SCOPe Domain Sequences for d5iclb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iclb2 d.224.1.0 (B:248-334) automated matches {Enterococcus faecalis [TaxId: 226185]}
kspafnlerrhrfpigsiemkmnvadgaiqeikifgdffglgeikdvediltgvkydkas
leeaidqidvkkyfgniekedllgliy

SCOPe Domain Coordinates for d5iclb2:

Click to download the PDB-style file with coordinates for d5iclb2.
(The format of our PDB-style files is described here.)

Timeline for d5iclb2:

  • d5iclb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16