Lineage for d5iclb1 (5icl B:1-247)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2186951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2187333Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2187334Protein automated matches [226887] (13 species)
    not a true protein
  7. 2287678Species Enterococcus faecalis [TaxId:226185] [330979] (5 PDB entries)
  8. 2287947Domain d5iclb1: 5icl B:1-247 [331248]
    Other proteins in same PDB: d5icla2, d5icla3, d5iclb2, d5iclb3
    automated match to d1vqza2
    complexed with laq

Details for d5iclb1

PDB Entry: 5icl (more details), 1.8 Å

PDB Description: crystal structure of enterococcus faecalis lipoate-protein ligase a (lpla-2) in complex with lipoyl-amp
PDB Compounds: (B:) Lipoate--protein ligase

SCOPe Domain Sequences for d5iclb1:

Sequence, based on SEQRES records: (download)

>d5iclb1 d.104.1.0 (B:1-247) automated matches {Enterococcus faecalis [TaxId: 226185]}
mifvpnenndprvnlaietylltempldepillfyinepsiiigrnqntieeinkeyvde
hgihvvrrlsgggavyhdhgnlnfsfimpddgnsfrdfakvtqpiiqalhdlgvegaelk
grndlvindmkfsgnamyatngrmfahgtlmfdsdidevvntlkvrkdkieskgiksvrs
rvtnikpflsedkqemtteefrqeillkifgvdsidqvktyeltdqdwaainkiseqyyr
nwdwnyg

Sequence, based on observed residues (ATOM records): (download)

>d5iclb1 d.104.1.0 (B:1-247) automated matches {Enterococcus faecalis [TaxId: 226185]}
mifvpnenndprvnlaietylltempldepillfyinepsiiigrnqntieeinkeyvde
hgihvvrrlsgggavyhdhgnlnfsfimpddgnsfrdfakvtqpiiqalhdlgvegaelk
grndlvindmkfsgnamyatngrmfahgtlmfdsdidevvntlkrvtnikpflsedkqem
tteefrqeillkifgvdsidqvktyeltdqdwaainkiseqyyrnwdwnyg

SCOPe Domain Coordinates for d5iclb1:

Click to download the PDB-style file with coordinates for d5iclb1.
(The format of our PDB-style files is described here.)

Timeline for d5iclb1:

  • d5iclb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16