Lineage for d5moya2 (5moy A:1093-1295)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053907Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 protein domains)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2053945Protein automated matches [229100] (4 species)
    not a true protein
  7. 2053946Species Clostridium botulinum [TaxId:1491] [229101] (9 PDB entries)
  8. 2287919Domain d5moya2: 5moy A:1093-1295 [331220]
    Other proteins in same PDB: d5moya1
    automated match to d3btaa2
    complexed with 2pe, edo

Details for d5moya2

PDB Entry: 5moy (more details), 2.3 Å

PDB Description: crystal structure of the bont/a2 receptor-binding domain in complex with the luminal domain of its neuronal receptor sv2c
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5moya2:

Sequence, based on SEQRES records: (download)

>d5moya2 b.42.4.2 (A:1093-1295) automated matches {Clostridium botulinum [TaxId: 1491]}
nsgilkdfwgnylqydkpyymlnlfdpnkyvdvnnigirgymylkgprgsvvttniylns
tlyegtkfiikkyasgnednivrnndrvyinvvvknkeyrlatnasqagvekilsaleip
dvgnlsqvvvmkskddqgirnkckmnlqdnngndigfigfhlydniaklvasnwynrqvg
kasrtfgcswefipvddgwgess

Sequence, based on observed residues (ATOM records): (download)

>d5moya2 b.42.4.2 (A:1093-1295) automated matches {Clostridium botulinum [TaxId: 1491]}
nsgilkdfwgnylqydkpyymlnlfdpnkyvdvnnigirgymylkgprgsvvttniylns
tlyegtkfiikkyanednivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdv
gnlsqvvvmksnkckmnlqdnngndigfigfhlydniaklvasnwynrqvgkasrtfgcs
wefipvddgwgess

SCOPe Domain Coordinates for d5moya2:

Click to download the PDB-style file with coordinates for d5moya2.
(The format of our PDB-style files is described here.)

Timeline for d5moya2:

  • d5moya2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16