SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5moya1 (5moy A:873-1092)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043490Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 protein domains)
    automatically mapped to Pfam PF07953
  6. 2043528Protein automated matches [229097] (3 species)
    not a true protein
  7. 2043529Species Clostridium botulinum [TaxId:1491] [229098] (8 PDB entries)
  8. 2287918Domain d5moya1: 5moy A:873-1092 [331219]
    Other proteins in same PDB: d5moya2
    automated match to d3btaa1
    complexed with 2pe, edo

Details for d5moya1

PDB Entry: 5moy (more details), 2.3 Å

PDB Description: crystal structure of the bont/a2 receptor-binding domain in complex with the luminal domain of its neuronal receptor sv2c
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5moya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5moya1 b.29.1.6 (A:873-1092) automated matches {Clostridium botulinum [TaxId: 1491]}
ivntsilsivykkddlidlsrygakinigdrvyydsidknqiklinlesstievilknai
vynsmyenfstsfwikipkyfskinlnneytiinciennsgwkvslnygeiiwtlqdnkq
niqrvvfkysqmvnisdyinrwifvtitnnrltkskiyingrlidqkpisnlgnihasnk
imfkldgcrdprryimikyfnlfdkelnekeikdlydsqs

SCOPe Domain Coordinates for d5moya1:

Click to download the PDB-style file with coordinates for d5moya1.
(The format of our PDB-style files is described here.)

Timeline for d5moya1:

  • d5moya1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16