Lineage for d1a5ud3 (1a5u D:2196-2330)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855807Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1855808Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1855809Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1855810Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1855848Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (7 PDB entries)
  8. 1855868Domain d1a5ud3: 1a5u D:2196-2330 [33120]
    Other proteins in same PDB: d1a5ua1, d1a5ua2, d1a5ub1, d1a5ub2, d1a5uc1, d1a5uc2, d1a5ud1, d1a5ud2, d1a5ue1, d1a5ue2, d1a5uf1, d1a5uf2, d1a5ug1, d1a5ug2, d1a5uh1, d1a5uh2
    complexed with atp, mg, na, oxl

Details for d1a5ud3

PDB Entry: 1a5u (more details), 2.35 Å

PDB Description: pyruvate kinase complex with bis mg-atp-na-oxalate
PDB Compounds: (D:) pyruvate kinase

SCOPe Domain Sequences for d1a5ud3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ud3 c.49.1.1 (D:2196-2330) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elarssshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOPe Domain Coordinates for d1a5ud3:

Click to download the PDB-style file with coordinates for d1a5ud3.
(The format of our PDB-style files is described here.)

Timeline for d1a5ud3: