SCOPe 2.06: Domain d4lhqb_: 4lhq B:

Lineage for d4lhqb_ (4lhq B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)

8. Domain d4lhqb_: 4lhq B: [331168]
   automated match to d4ocmc_

Details for d4lhqb_

PDB Entry: 4lhq, 2.3 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh8)

PDB Compounds: (B:) Camelid nanobody

SCOPe Domain Sequences for d4lhqb_:

Sequence; same for both SEQRES and ATOM records:

>d4lhqb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvetgggtvqtggslrlscsasggsfsrnamgwfrqapgkerefvaainwsasstyyr
dsvkgrftvsrdnakntvylhlnslkledtaayycagssvyaempyadsvkatsynywgq
gtqvtvss

Timeline for d4lhqb_:

• d4lhqb_ is new in SCOPe 2.06-stable
  
• d4lhqb_ appears in SCOPe 2.07
  
• d4lhqb_ appears in the current release, SCOPe 2.08