SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lhqb_ (4lhq B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020506Species Vicugna pacos [TaxId:30538] [189756] (22 PDB entries)
  8. 2287867Domain d4lhqb_: 4lhq B: [331168]
    automated match to d4ocmc_

Details for d4lhqb_

PDB Entry: 4lhq (more details), 2.3 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh8)
PDB Compounds: (B:) Camelid nanobody

SCOPe Domain Sequences for d4lhqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhqb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvetgggtvqtggslrlscsasggsfsrnamgwfrqapgkerefvaainwsasstyyr
dsvkgrftvsrdnakntvylhlnslkledtaayycagssvyaempyadsvkatsynywgq
gtqvtvss

SCOPe Domain Coordinates for d4lhqb_:

Click to download the PDB-style file with coordinates for d4lhqb_.
(The format of our PDB-style files is described here.)

Timeline for d4lhqb_:

  • d4lhqb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16

View in 3D
Domains from other chains:
(mouse over for more information)
d4lhqd_