![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.14: Histone demethylase core [254153] (4 protein domains) Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801 |
![]() | Protein automated matches [254635] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255633] (263 PDB entries) |
![]() | Domain d5pj9a_: 5pj9 A: [331153] automated match to d3dxua_ complexed with edo, mg, ni, oga, so4, zn |
PDB Entry: 5pj9 (more details), 1.5 Å
SCOPe Domain Sequences for d5pj9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5pj9a_ b.82.2.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc scgearvtfsmdafvrilqperydlwkrgqd
Timeline for d5pj9a_: