Lineage for d5lgja3 (5lgj A:439-545)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2287812Domain d5lgja3: 5lgj A:439-545 [331113]
    automated match to d1o0va3
    complexed with bma, gol, man, nag, pg4, so4; mutant

Details for d5lgja3

PDB Entry: 5lgj (more details), 2.6 Å

PDB Description: the crystal structure of ige fc mutant - p333c
PDB Compounds: (A:) ig epsilon chain c region

SCOPe Domain Sequences for d5lgja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lgja3 b.1.1.0 (A:439-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

SCOPe Domain Coordinates for d5lgja3:

Click to download the PDB-style file with coordinates for d5lgja3.
(The format of our PDB-style files is described here.)

Timeline for d5lgja3:

  • d5lgja3 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16